Emu Athena 2 Seater Sofa

2 seater Sofa from the Athena collection.

1.159,00 

Delivery within 4 weeks
Secure Payments visamasterpaypalklarnasatispaybonifico

Description

Athena 2 Seater Sofa

Emu Athena Line

The Athena line, in steel, is a collection with a classic style for a convivial but refined atmosphere. This collection is characterized by an unmistakable decorative motif in woven sheet metal, which gives elegance and character to the collection. Athena is a family of furniture that includes seating, tables and lounge furniture for every moment of outdoor relaxation. The enveloping and soft forms of chairs and chaise longues are combined with delicacy and balanced elegance.

 

athena emu 3

 

athena emu 2

 

athena emu

 

Additional information

Weight 13,9 kg
Dimensions 134 × 78 × 78 cm
Color

Marrone d'India, Ferro Antico, Bianco Opaco, Nero